McDonnell Genome Institute

Washington University

Transcript

lnc-SLC25A18-1:1

Chromosome

chr22

Gene Name

lnc-SLC25A18-1

Start

17418696

CPC Label

coding

End

17419828

Cancer

EOGC

Strand

+

Peptide

LEVGAAIMMIPQLMEK

Modified Peptide

n[145]LEVGAAIMMIPQLMEK

Peptide Length

16

ORF Length

39

Open Reading Frame (ORF)

LEVGAAIMMIPQLMEKFNLDLSTVTQAFLKNSGELELES

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.708913

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9287

PhyloCSF Frame 3

0

CNTI Score

-0.272833312