McDonnell Genome Institute

Washington University

Transcript

lnc-SLC25A17-4:1

Chromosome

chr22

Gene Name

lnc-SLC25A17-4

Start

40738869

CPC Label

noncoding

End

40744390

Cancer

OV

Strand

-

Peptide

MRLIYTDDNALEFNIVSAMIYEHIWK

Modified Peptide

n[145]MRLIYTDDNALEFNIVSAM[147]IYEHIWK

Peptide Length

26

ORF Length

36

Open Reading Frame (ORF)

MRLIYTDDNALEFNIVSAMIYEHIWKRNRIRGQWFK

Conservation Score

0.916

PhyloCSF Frame 1

-1.772

No. of Spectra

1

CPC Coding Probability

0.255803

PhyloCSF Frame 2 

-5.447

CNTI Index

noncoding

Max Probability

0.3574

PhyloCSF Frame 3

-2.664

CNTI Score

-0.356371497