McDonnell Genome Institute

Washington University

Transcript

lnc-SLC25A17-2:1

Chromosome

chr22

Gene Name

lnc-SLC25A17-2

Start

40586699

CPC Label

noncoding

End

40588003

Cancer

HCC

Strand

-

Peptide

KGSHLAK

Modified Peptide

KGSHLAK

Peptide Length

7

ORF Length

36

Open Reading Frame (ORF)

MDVLIHCYQCTLKKGSHLAKMSLCLLYSRLPFHQIL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.0829809

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.997

PhyloCSF Frame 3

0

CNTI Score

-0.305245585