McDonnell Genome Institute

Washington University

Transcript

lnc-SLC25A15-9:1

Chromosome

chr13

Gene Name

lnc-SLC25A15-9

Start

40539404

CPC Label

noncoding

End

40542232

Cancer

CCRC

Strand

+

Peptide

GVTCTLR

Modified Peptide

n[230]GVTCTLR

Peptide Length

7

ORF Length

42

Open Reading Frame (ORF)

MGVTCTLRKTLRIHIKKSNVLPGIMAHACNPSTLGGRGRQIT

Conservation Score

0.625

PhyloCSF Frame 1

0

No. of Spectra

13

CPC Coding Probability

0.118106

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9984

PhyloCSF Frame 3

0

CNTI Score

-0.332557266