McDonnell Genome Institute

Washington University

Transcript

lnc-SLC25A15-4:1

Chromosome

chr13

Gene Name

lnc-SLC25A15-4

Start

40904925

CPC Label

noncoding

End

40905687

Cancer

EOGC

Strand

+

Peptide

AQLPFSMTQTNLILFHNR

Modified Peptide

n[145]AQLPFSM[147]TQTNLILFHNR

Peptide Length

18

ORF Length

45

Open Reading Frame (ORF)

LHFLLQPSEPVSFLKAQLPFSMTQTNLILFHNRKFHMSLELQVNK

Conservation Score

0.196

PhyloCSF Frame 1

-4.967

No. of Spectra

1

CPC Coding Probability

0.00958218

PhyloCSF Frame 2 

-5.345

CNTI Index

noncoding

Max Probability

0.0502

PhyloCSF Frame 3

-4.316

CNTI Score

-0.351824692