McDonnell Genome Institute

Washington University

Transcript

lnc-SLC25A13-1:1

Chromosome

chr7

Gene Name

lnc-SLC25A13-1

Start

96622005

CPC Label

noncoding

End

96664338

Cancer

BRCA-Basal-like

Strand

-

Peptide

GGLDMEIK

Modified Peptide

n[145]GGLDMEIK

Peptide Length

8

ORF Length

67

Open Reading Frame (ORF)

LQNCPKLTLGTKEKKYNLSWKLLKCKINQVRGGLDMEIKLSCLDLEGHHPKENGHVLTDEIFRIPDR

Conservation Score

0.983

PhyloCSF Frame 1

-5.576

No. of Spectra

5

CPC Coding Probability

0.124813

PhyloCSF Frame 2 

-5.745

CNTI Index

noncoding

Max Probability

0.9952

PhyloCSF Frame 3

-5.177

CNTI Score

-0.357738804