McDonnell Genome Institute

Washington University

Transcript

lnc-SLC25A1-5:3

Chromosome

chr22

Gene Name

lnc-SLC25A1-5

Start

19165827

CPC Label

noncoding

End

19171614

Cancer

EOGC

Strand

-

Peptide

GFLALEHSSSPSAFSLAWMGESLVTAEGR

Modified Peptide

n[145]GFLALEHSSSPSAFSLAWMGESLVTAEGR

Peptide Length

29

ORF Length

69

Open Reading Frame (ORF)

LACVSQNWASPASPAPHRTPDRCGRGFLALEHSSSPSAFSLAWMGESLVTAEGRKGGREMRGKERQMYL

Conservation Score

0.092

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.058878

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.096

PhyloCSF Frame 3

0

CNTI Score

-0.33505001