McDonnell Genome Institute

Washington University

Transcript

lnc-SLC24A1-5:1

Chromosome

chr15

Gene Name

lnc-SLC24A1-5

Start

65884614

CPC Label

noncoding

End

65887152

Cancer

BRCA-Luminal B

Strand

+

Peptide

EMTHLPMAFRGLCHSGKTGYGK

Modified Peptide

n[145]EMTHLPMAFRGLCHSGKTGYGK

Peptide Length

22

ORF Length

118

Open Reading Frame (ORF)

LEKRHTKFINMYTVHWFSLGRTREMTHLPMAFRGLCHSGKTGYGKEEKRNSVEGITGEDERISGQKLIGTLSRERVCLSVVTFLILQGGEEKTIVPFSGSGSQADEGTSASSCARERG

Conservation Score

0.728

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.143872

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1459

PhyloCSF Frame 3

0

CNTI Score

-0.398742937