McDonnell Genome Institute

Washington University

Transcript

lnc-SLC24A1-1:1

Chromosome

chr15

Gene Name

lnc-SLC24A1-1

Start

65850874

CPC Label

noncoding

End

65860343

Cancer

BRCA-Luminal B

Strand

+

Peptide

GGVVLGR

Modified Peptide

n[145]GGVVLGR

Peptide Length

7

ORF Length

51

Open Reading Frame (ORF)

LELWVGIIPPKLPGCFLDGRGGVVLGRKPQCWQPGGNKLHFPSLLYFYIVC

Conservation Score

0.368

PhyloCSF Frame 1

-3.421

No. of Spectra

1

CPC Coding Probability

0.0140606

PhyloCSF Frame 2 

-4.708

CNTI Index

noncoding

Max Probability

0.6439

PhyloCSF Frame 3

-4.633

CNTI Score

-0.429941841