McDonnell Genome Institute

Washington University

Transcript

lnc-SLC22A5-1:1

Chromosome

chr5

Gene Name

lnc-SLC22A5-1

Start

132350418

CPC Label

noncoding

End

132365720

Cancer

LUAD

Strand

+

Peptide

YIAFGDK

Modified Peptide

n[230]YIAFGDK

Peptide Length

7

ORF Length

39

Open Reading Frame (ORF)

LDKITILCTYASIFVMPTNTPVKANRAKYIAFGDKCSRT

Conservation Score

0.122

PhyloCSF Frame 1

-4.708

No. of Spectra

8

CPC Coding Probability

0.0216308

PhyloCSF Frame 2 

-4.237

CNTI Index

noncoding

Max Probability

0.9981

PhyloCSF Frame 3

-3.601

CNTI Score

-0.409813855