McDonnell Genome Institute

Washington University

Transcript

lnc-SLC22A31-2:1

Chromosome

chr16

Gene Name

lnc-SLC22A31-2

Start

89113174

CPC Label

noncoding

End

89115279

Cancer

EOGC

Strand

-

Peptide

LAHLGGLR

Modified Peptide

n[145]LAHLGGLR

Peptide Length

8

ORF Length

85

Open Reading Frame (ORF)

LSHGGASSMPPFSPNVGGSRLAHLGGLRAQWKRNAAVGSARTWQAHGSGQGPGQSHADLGHAIPLQQGVARDVLPLLQHWEGQGS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

63

CPC Coding Probability

0.190654

PhyloCSF Frame 2 

-4.422

CNTI Index

noncoding

Max Probability

0.9984

PhyloCSF Frame 3

14.222

CNTI Score

-0.281730406