McDonnell Genome Institute

Washington University

Transcript

lnc-SLC22A23-2:5

Chromosome

chr6

Gene Name

lnc-SLC22A23-2

Start

3463188

CPC Label

noncoding

End

3464752

Cancer

PRAD

Strand

-

Peptide

MPVISDTQEAEAGEHMARAGAR

Modified Peptide

Peptide Length

22

ORF Length

67

Open Reading Frame (ORF)

MPVISDTQEAEAGEHMARAGARVGVGVRLLLCSEKPKTPGQSAVALSGLTASSTSQVHAILLPQPPE

Conservation Score

0.266

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.353005

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5257

PhyloCSF Frame 3

0

CNTI Score

-0.339553243