McDonnell Genome Institute

Washington University

Transcript

lnc-SLC22A18-6:1

Chromosome

chr11

Gene Name

lnc-SLC22A18-6

Start

2929844

CPC Label

noncoding

End

2930433

Cancer

OV

Strand

+

Peptide

EVPGAEGFGLGR

Modified Peptide

n[145]EVPGAEGFGLGR

Peptide Length

12

ORF Length

72

Open Reading Frame (ORF)

LGYGLLRPRPHDPDRREVPGAEGFGLGRDARSLGSAWGRGSAGAAESSLSSWADGRFYLPSSFKGFNRQEAK

Conservation Score

1

PhyloCSF Frame 1

-2.367

No. of Spectra

6

CPC Coding Probability

0.0197613

PhyloCSF Frame 2 

-4.431

CNTI Index

noncoding

Max Probability

0.9228

PhyloCSF Frame 3

-4.752

CNTI Score

-0.357303778