McDonnell Genome Institute

Washington University

Transcript

lnc-SLC20A2-1:1

Chromosome

chr8

Gene Name

lnc-SLC20A2-1

Start

42560405

CPC Label

noncoding

End

42568197

Cancer

OSCC

Strand

-

Peptide

MAAILLLLTFRPCIFNLLVK

Modified Peptide

n[145]MAAILLLLTFRPCIFNLLVK

Peptide Length

20

ORF Length

48

Open Reading Frame (ORF)

MAAILLLLTFRPCIFNLLVKFVSSGIKAVKLQMVLQMEPQMSSTNNFY

Conservation Score

0.388

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.160529

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6294

PhyloCSF Frame 3

0

CNTI Score

-0.340529403