McDonnell Genome Institute

Washington University

Transcript

lnc-SLC1A2-2:1

Chromosome

chr11

Gene Name

lnc-SLC1A2-2

Start

35132654

CPC Label

noncoding

End

35138032

Cancer

OV

Strand

-

Peptide

GTMPGLLREGRVFGTEK

Modified Peptide

n[145]GTM[147]PGLLREGRVFGTEK

Peptide Length

17

ORF Length

53

Open Reading Frame (ORF)

MKVIISGCGKMKGTMPGLLREGRVFGTEKSLSGSSPQPLRSWHAMTQRAARLE

Conservation Score

0.027

PhyloCSF Frame 1

-4.358

No. of Spectra

1

CPC Coding Probability

0.114317

PhyloCSF Frame 2 

-6.397

CNTI Index

noncoding

Max Probability

0.3347

PhyloCSF Frame 3

-5.629

CNTI Score

-0.372547218