McDonnell Genome Institute

Washington University

Transcript

lnc-SLC1A1-9:1

Chromosome

chr9

Gene Name

lnc-SLC1A1-9

Start

4474157

CPC Label

noncoding

End

4476133

Cancer

EOGC

Strand

+

Peptide

FLSLVNLLNK

Modified Peptide

n[145]FLSLVNLLNK

Peptide Length

10

ORF Length

59

Open Reading Frame (ORF)

MLFFVVLFVTAKYWKQTRFLSLVNLLNKLWIHPHSVVFCSSAKESGRFLYNKPTQRNIK

Conservation Score

0.77

PhyloCSF Frame 1

-5.311

No. of Spectra

16

CPC Coding Probability

0.0335917

PhyloCSF Frame 2 

-4.72

CNTI Index

noncoding

Max Probability

0.9974

PhyloCSF Frame 3

-3.682

CNTI Score

-0.381783942