McDonnell Genome Institute

Washington University

Transcript

lnc-SLC1A1-1:3

Chromosome

chr9

Gene Name

lnc-SLC1A1-1

Start

4298100

CPC Label

noncoding

End

4300086

Cancer

CCRC

Strand

+

Peptide

LPNTSSK

Modified Peptide

n[230]LPNTSSK

Peptide Length

7

ORF Length

36

Open Reading Frame (ORF)

LWFPFASRLPNTSSKSEGANAEPETLPQSFSRQVPN

Conservation Score

1

PhyloCSF Frame 1

-1.405

No. of Spectra

1

CPC Coding Probability

0.0442744

PhyloCSF Frame 2 

-3.211

CNTI Index

noncoding

Max Probability

0.9997

PhyloCSF Frame 3

0.613

CNTI Score

-0.29490061