McDonnell Genome Institute

Washington University

Transcript

lnc-SLC19A1-5:2

Chromosome

chr21

Gene Name

lnc-SLC19A1-5

Start

45582844

CPC Label

noncoding

End

45590585

Cancer

OV

Strand

-

Peptide

LQTFLPVR

Modified Peptide

n[145]LQTFLPVR

Peptide Length

8

ORF Length

78

Open Reading Frame (ORF)

LPLTPPTRAFPSAPAPFELPGRARSSGQPRPRPPRRLQTFLPVRETEGGLFLENQCLRFPPGGLDLKTRPSRGEYATP

Conservation Score

0.062

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.200722

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9983

PhyloCSF Frame 3

0

CNTI Score

-0.322107159