McDonnell Genome Institute

Washington University

Transcript

lnc-SLC19A1-3:1

Chromosome

chr21

Gene Name

lnc-SLC19A1-3

Start

45827960

CPC Label

noncoding

End

45836419

Cancer

OSCC

Strand

-

Peptide

WRVTTSLSIPR

Modified Peptide

n[145]WRVTTSLSIPR

Peptide Length

11

ORF Length

47

Open Reading Frame (ORF)

LLPAGKLPRARERRAEGTALLLHRQQGQRWRVTTSLSIPRLSGKASS

Conservation Score

0.013

PhyloCSF Frame 1

-2.291

No. of Spectra

7

CPC Coding Probability

0.188945

PhyloCSF Frame 2 

-4.836

CNTI Index

noncoding

Max Probability

0.9996

PhyloCSF Frame 3

-3.779

CNTI Score

-0.285644957