McDonnell Genome Institute

Washington University

Transcript

lnc-SLC17A9-1:1

Chromosome

chr20

Gene Name

lnc-SLC17A9-1

Start

62969983

CPC Label

noncoding

End

62973037

Cancer

CCRC

Strand

+

Peptide

GGWQGAK

Modified Peptide

n[230]GGWQGAK

Peptide Length

7

ORF Length

69

Open Reading Frame (ORF)

LAVAVIRCRADRGCRRTGLCRLSELPAKLSPAWDSAWGRSRPLCCERRERVARETYEVEEQRGGWQGAK

Conservation Score

0.432

PhyloCSF Frame 1

-3.455

No. of Spectra

8

CPC Coding Probability

0.213871

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9968

PhyloCSF Frame 3

-4.182

CNTI Score

-0.276050121