McDonnell Genome Institute

Washington University

Transcript

lnc-SLC17A5-1:4

Chromosome

chr6

Gene Name

lnc-SLC17A5-1

Start

73689714

CPC Label

noncoding

End

73696021

Cancer

OV

Strand

-

Peptide

LSPGPNQMDIGR

Modified Peptide

n[145]LSPGPNQM[147]DIGR

Peptide Length

12

ORF Length

39

Open Reading Frame (ORF)

LSPGPNQMDIGRGETRTGREQLVAFLVSLPSHALLPLEK

Conservation Score

0.201

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0323001

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4032

PhyloCSF Frame 3

0

CNTI Score

-0.357745878