McDonnell Genome Institute

Washington University

Transcript

lnc-SLC16A7-8:1

Chromosome

chr12

Gene Name

lnc-SLC16A7-8

Start

60844668

CPC Label

noncoding

End

60844875

Cancer

CCRC

Strand

+

Peptide

LTLSSFLK

Modified Peptide

n[230]LTLSSFLK

Peptide Length

8

ORF Length

40

Open Reading Frame (ORF)

LTLSSFLKFSIAFVVCFFEVLKFISYPFFFFLNAIIMLRK

Conservation Score

0.037

PhyloCSF Frame 1

0

No. of Spectra

13

CPC Coding Probability

0.00607523

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9964

PhyloCSF Frame 3

0

CNTI Score

-0.565991067