McDonnell Genome Institute

Washington University

Transcript

lnc-SLC16A6-2:1

Chromosome

chr17

Gene Name

lnc-SLC16A6-2

Start

68125776

CPC Label

coding

End

68152468

Cancer

BRCA-Luminal B

Strand

-

Peptide

LHCNSACLTNTTHCRESK

Modified Peptide

n[145]LHCNSACLTNTTHCRESK

Peptide Length

18

ORF Length

277

Open Reading Frame (ORF)

MNVSAFFFRYMGTTQVPLTTIKNILRMTVELEKLLHPEPTVAQPTAYPRVPILPSHMACCLCQFKNSIEAVCKTVKLHCNSACLTNTTHCRESKLPGDKLLHYFKYLCRSIIFHDQSSLFFLTGEEASVGNPERVFMKVLQAQKKHMSIELTTEPEAASDSSGINLSVFGSEQLDTYDKSDVITALNYILPYFSAGNLDAESMLLPFIKLNSLAKVQSVGKNLQRVNRVLMGPRSIQKRPFKAVGKQSIRREQGAQAFGENAAKEKRLGSPAPRELE

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.998994

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.3102

PhyloCSF Frame 3

2.593

CNTI Score

0.777187851