McDonnell Genome Institute

Washington University

Transcript

lnc-SLC16A3-2:2

Chromosome

chr17

Gene Name

lnc-SLC16A3-2

Start

82212927

CPC Label

noncoding

End

82215363

Cancer

OSCC

Strand

+

Peptide

VDLSFCPEMKGARGGR

Modified Peptide

n[145]VDLSFCPEMKGARGGR

Peptide Length

16

ORF Length

77

Open Reading Frame (ORF)

LRPPGSRSRRVDLSFCPEMKGARGGRGCPWGSVRAGGATKSCLRVGCGHRGTSSRRCPRARRPAGPRGRARGRSDPD

Conservation Score

0.387

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.393456

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9184

PhyloCSF Frame 3

0

CNTI Score

-0.304662068