McDonnell Genome Institute

Washington University

Transcript

lnc-SLC16A3-2:1

Chromosome

chr17

Gene Name

lnc-SLC16A3-2

Start

82214226

CPC Label

noncoding

End

82217352

Cancer

CCRC

Strand

+

Peptide

EAPLDRK

Modified Peptide

n[230]EAPLDRK

Peptide Length

7

ORF Length

114

Open Reading Frame (ORF)

LPGSQVLRPERSQEMKGPGGCEWASVSGCSRRRGVGTDSCLRAGGREAPLDRKTLQEQTSKTGTVQMGPGAGQRRQTCPTAAVTTATSWRSRPGGRASAARDPGVDTGRTRGCS

Conservation Score

0.106

PhyloCSF Frame 1

-3.239

No. of Spectra

9

CPC Coding Probability

0.113314

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9984

PhyloCSF Frame 3

-4.008

CNTI Score

-0.261998108