McDonnell Genome Institute

Washington University

Transcript

lnc-SLC16A11-7:3

Chromosome

chr17

Gene Name

lnc-SLC16A11-7

Start

7015821

CPC Label

coding

End

7019659

Cancer

OV

Strand

-

Peptide

AEGRPGVGGGER

Modified Peptide

n[145]AEGRPGVGGGER

Peptide Length

12

ORF Length

200

Open Reading Frame (ORF)

LALGFCFLRGVFKKSSPGQEKRAEGRPGVGGGERHVCLSLNVALWGGPACPGLVDGLMEVAVGAGSGPQGPWGVGTALGVEYLAPQVQMALFLGSAAPLPPGLHFLPLASILWQAQGPGRLPAPLSQPCSGPTTSGLPTPNPAGLGPLSLLAFLLGSDPGRGRTDTGSLGSLPLLRQEAVCWPLQSFPISSASDPTLGIP

Conservation Score

1

PhyloCSF Frame 1

-0.164

No. of Spectra

11

CPC Coding Probability

0.711616

PhyloCSF Frame 2 

0.109

CNTI Index

noncoding

Max Probability

0.8439

PhyloCSF Frame 3

1.358

CNTI Score

-0.294891657