McDonnell Genome Institute

Washington University

Transcript

lnc-SLC16A1-2:6

Chromosome

chr1

Gene Name

lnc-SLC16A1-2

Start

113006686

CPC Label

noncoding

End

113073097

Cancer

OSCC

Strand

-

Peptide

NCMPLLK

Modified Peptide

n[145]NCMPLLK

Peptide Length

7

ORF Length

92

Open Reading Frame (ORF)

LGSSNSPASASQVAGITGARHHGQLIFVFLVEMGFHHVGQAGLQLLTSGDPPTSASQSAGITVVSAAPIRNCMPLLKTLKIILRAGLGGSCL

Conservation Score

0.981

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0519191

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7491

PhyloCSF Frame 3

0

CNTI Score

-0.370389728