McDonnell Genome Institute

Washington University

Transcript

lnc-SLC16A1-2:4

Chromosome

chr1

Gene Name

lnc-SLC16A1-2

Start

113038621

CPC Label

noncoding

End

113073097

Cancer

BRCA-Basal-like

Strand

-

Peptide

ASVEPIQR

Modified Peptide

n[145]ASVEPIQR

Peptide Length

8

ORF Length

69

Open Reading Frame (ORF)

MRFWVARGIVQYQKNFKTQSLTGKVLADFRDKASVEPIQRKGFSLSRPSCSTTKRLAAGIYLFPAKLEG

Conservation Score

0.955

PhyloCSF Frame 1

0

No. of Spectra

58

CPC Coding Probability

0.110043

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9964

PhyloCSF Frame 3

0

CNTI Score

-0.346252893