McDonnell Genome Institute

Washington University

Transcript

lnc-SLC15A4-25:1

Chromosome

chr12

Gene Name

lnc-SLC15A4-25

Start

126899669

CPC Label

noncoding

End

126901178

Cancer

OV

Strand

-

Peptide

SFLRPLLGR

Modified Peptide

n[145]SFLRPLLGR

Peptide Length

9

ORF Length

62

Open Reading Frame (ORF)

LTFLCSLSQVARGPRDWASCQTTRYKKSSGPRLCRSFLRPLLGRARTSGRLWNPGCSFPVWG

Conservation Score

0.073

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0191409

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7825

PhyloCSF Frame 3

0

CNTI Score

-0.340956521