McDonnell Genome Institute

Washington University

Transcript

lnc-SLC15A4-17:1

Chromosome

chr12

Gene Name

lnc-SLC15A4-17

Start

128599406

CPC Label

noncoding

End

128608295

Cancer

OV

Strand

-

Peptide

LGQSWADQAELER

Modified Peptide

n[145]LGQSWADQAELER

Peptide Length

13

ORF Length

38

Open Reading Frame (ORF)

LGQSWADQAELERLNQPSFNWKFLIRPGMSKMKFSATR

Conservation Score

0.006

PhyloCSF Frame 1

-4.584

No. of Spectra

7

CPC Coding Probability

0.0368523

PhyloCSF Frame 2 

-4.095

CNTI Index

noncoding

Max Probability

0.9229

PhyloCSF Frame 3

-4.472

CNTI Score

-0.332959412