McDonnell Genome Institute

Washington University

Transcript

lnc-SLC15A4-16:1

Chromosome

chr12

Gene Name

lnc-SLC15A4-16

Start

128717538

CPC Label

noncoding

End

128728176

Cancer

EOGC

Strand

-

Peptide

ETNSVAFSLWPK

Modified Peptide

n[145]ETNSVAFSLWPK

Peptide Length

12

ORF Length

68

Open Reading Frame (ORF)

MKGSLLERTGSHNYKVKSQDRPFARWGRKKPVVVQLESKSLKIRETNSVAFSLWPKAQEPPANHWYKY

Conservation Score

0.745

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0694376

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7131

PhyloCSF Frame 3

0

CNTI Score

-0.374884656