McDonnell Genome Institute

Washington University

Transcript

lnc-SLC15A3-1:1

Chromosome

chr11

Gene Name

lnc-SLC15A3-1

Start

60918468

CPC Label

noncoding

End

60925397

Cancer

PRAD

Strand

-

Peptide

EVAALSR

Modified Peptide

‚Äč

Peptide Length

7

ORF Length

80

Open Reading Frame (ORF)

LSLCLLWHPLPCSHSPASPGQGSPTPTPKHREVAALSRSDRNPLKGSGRQGCGHPWRRQGPSCEVAFILLAPTGTDEKKL

Conservation Score

0.95

PhyloCSF Frame 1

-3.493

No. of Spectra

20

CPC Coding Probability

0.00989724

PhyloCSF Frame 2 

-3.12

CNTI Index

noncoding

Max Probability

0.9959

PhyloCSF Frame 3

-2.892

CNTI Score

-0.351696195