McDonnell Genome Institute

Washington University

Transcript

lnc-SLC14A2-3:2

Chromosome

chr18

Gene Name

lnc-SLC14A2-3

Start

45168569

CPC Label

noncoding

End

45169292

Cancer

OV

Strand

+

Peptide

AWNMMLTSHDETSHMK

Modified Peptide

n[145]AWNM[147]M[147]LTSHDETSHMK

Peptide Length

16

ORF Length

35

Open Reading Frame (ORF)

LFWWKRNFFFYEALRAWNMMLTSHDETSHMKYNFC

Conservation Score

0.422

PhyloCSF Frame 1

-5.689

No. of Spectra

1

CPC Coding Probability

0.0124589

PhyloCSF Frame 2 

-4.474

CNTI Index

noncoding

Max Probability

0.5587

PhyloCSF Frame 3

-6.709

CNTI Score

-0.562825872