McDonnell Genome Institute

Washington University

Transcript

lnc-SLC14A1-1:1

Chromosome

chr18

Gene Name

lnc-SLC14A1-1

Start

45775267

CPC Label

noncoding

End

45788586

Cancer

OV

Strand

+

Peptide

VAYEAMTQVPQCLGPRFAAWNQRR

Modified Peptide

n[145]VAYEAMTQVPQCLGPRFAAWNQRR

Peptide Length

24

ORF Length

123

Open Reading Frame (ORF)

LGGKKWGEGEGRRTGLLEAGFLPKGRYATVRNITPSPSILRKVAYEAMTQVPQCLGPRFAAWNQRRGAAARGSCAKPKGQPQTRNLTRLAGLMAESPWRRGSSGPVLPGGPGWSPLQSRVSGP

Conservation Score

0.054

PhyloCSF Frame 1

-3.501

No. of Spectra

6

CPC Coding Probability

0.0705457

PhyloCSF Frame 2 

-3.725

CNTI Index

noncoding

Max Probability

0.5927

PhyloCSF Frame 3

0

CNTI Score

-0.313703831