McDonnell Genome Institute

Washington University

Transcript

lnc-SLC12A7-5:14

Chromosome

chr5

Gene Name

lnc-SLC12A7-5

Start

1170641

CPC Label

coding

End

1182847

Cancer

OV

Strand

-

Peptide

AARAPADGVGGGGEPGK

Modified Peptide

n[145]AARAPADGVGGGGEPGK

Peptide Length

17

ORF Length

118

Open Reading Frame (ORF)

LALGPSLGLLWGGGRRSRRGRAARAPADGVGGGGEPGKCGRLGESQMEVWYLEPGERRLSGQRASDSGTPAVPMTSSMGEEPGTWMHGCEAPTPQGPQRHRLQAPAGRALHPTLGAWL

Conservation Score

0.119

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.888459

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.0653

PhyloCSF Frame 3

0

CNTI Score

-0.258349532