McDonnell Genome Institute

Washington University

Transcript

lnc-SLC11A2-7:1

Chromosome

chr12

Gene Name

lnc-SLC11A2-7

Start

50760485

CPC Label

noncoding

End

50763939

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

DGVSLQSQLLGR

Modified Peptide

n[145]DGVSLQSQLLGR

Peptide Length

12

ORF Length

123

Open Reading Frame (ORF)

LRSGVRDQPGKYDETPSLLKIQKLARRDGVSLQSQLLGRLRQENRLNPGGGICGEPRSCHCTPGWATVRLHLKKKKQKQKTTTQLTEEKKKKSYACSTLPLKNTSAFLVSFSLKYHKLCLPVF

Conservation Score

0.54

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0498327

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

0

CNTI Score

-0.355383182