McDonnell Genome Institute

Washington University

Transcript

lnc-SLC11A1-1:1

Chromosome

chr2

Gene Name

lnc-SLC11A1-1

Start

218398702

CPC Label

noncoding

End

218400070

Cancer

OV

Strand

+

Peptide

LQAGTRGGPCAAEPGSPPLRSSR

Modified Peptide

n[145]LQAGTRGGPCAAEPGSPPLRSSR

Peptide Length

23

ORF Length

133

Open Reading Frame (ORF)

LRASGLRSPTVGLWAHRVRRRAGLLGSAASPVTPTAPPVITGRPSTAGRGGGLGRPLEKVAFPRGRWNLATRKEQRVRKLQAGTRGGPCAAEPGSPPLRSSRGSLPPTPPLPPAPRFRPQPGGRPGARARVRP

Conservation Score

1

PhyloCSF Frame 1

1.313

No. of Spectra

1

CPC Coding Probability

0.00437091

PhyloCSF Frame 2 

6.125

CNTI Index

noncoding

Max Probability

0.1029

PhyloCSF Frame 3

0.475

CNTI Score

-0.327779935