McDonnell Genome Institute

Washington University

Transcript

lnc-SLAMF8-1:13

Chromosome

chr1

Gene Name

lnc-SLAMF8-1

Start

159866953

CPC Label

noncoding

End

159867685

Cancer

OV

Strand

+

Peptide

ETQSLSSQNTPSDTEIAPGPQCGK

Modified Peptide

n[145]ETQSLSSQNTPSDTEIAPGPQCGK

Peptide Length

24

ORF Length

49

Open Reading Frame (ORF)

LQNLHSFSKQPGFVLGPGEMAIKETQSLSSQNTPSDTEIAPGPQCGKMQ

Conservation Score

0.358

PhyloCSF Frame 1

-2.708

No. of Spectra

7

CPC Coding Probability

0.0168249

PhyloCSF Frame 2 

-5.182

CNTI Index

noncoding

Max Probability

0.9225

PhyloCSF Frame 3

-4.51

CNTI Score

-0.341685508