McDonnell Genome Institute

Washington University

Transcript

lnc-SLA2-4:1

Chromosome

chr20

Gene Name

lnc-SLA2-4

Start

36549126

CPC Label

noncoding

End

36605497

Cancer

OV

Strand

-

Peptide

RHGLCSLQPPPPGFK

Modified Peptide

n[145]RHGLCSLQPPPPGFK

Peptide Length

15

ORF Length

94

Open Reading Frame (ORF)

LVSPETKAHPFWTVDFFFFFFLRRHGLCSLQPPPPGFKRFSCLSLPRSWDHRRPLPRSTSFFCILVETGVSLCCPGWSRTPELRQSAHLGLPKC

Conservation Score

0.702

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.180373

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9311

PhyloCSF Frame 3

0

CNTI Score

-0.337498926