McDonnell Genome Institute

Washington University

Transcript

lnc-SLA2-1:1

Chromosome

chr20

Gene Name

lnc-SLA2-1

Start

36591049

CPC Label

coding

End

36593941

Cancer

HCC

Strand

-

Peptide

SLGLITER

Modified Peptide

n[230]SLGLITER

Peptide Length

8

ORF Length

90

Open Reading Frame (ORF)

MSTPGLTETAQGQLGPNIGLNLAAFLSPAQETRLEQRCPRDFLEKQQKQQHHACLRSLGLITERRPGETAESAEERAPITVQWCQLASSC

Conservation Score

1

PhyloCSF Frame 1

0.122

No. of Spectra

6

CPC Coding Probability

0.64565

PhyloCSF Frame 2 

-3.897

CNTI Index

noncoding

Max Probability

0.9972

PhyloCSF Frame 3

-1.142

CNTI Score

-0.355291322