McDonnell Genome Institute

Washington University

Transcript

lnc-SKOR1-5:1

Chromosome

chr15

Gene Name

lnc-SKOR1-5

Start

67840333

CPC Label

noncoding

End

67842935

Cancer

OV

Strand

+

Peptide

DPSEAWGHPLWAGR

Modified Peptide

n[145]DPSEAWGHPLWAGR

Peptide Length

14

ORF Length

127

Open Reading Frame (ORF)

LPARLSTGAGAARRVQTRALTQTLIPETTEQCLRDAKAFLERGAMVPMGFPRVLDSGPRKGCESLVGPFPARGPERRDPSEAWGHPLWAGRGRQGLRRGIVGRVGQGAPSASPRLLGTSSLHSEPRR

Conservation Score

0.065

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.124658

PhyloCSF Frame 2 

-2.207

CNTI Index

noncoding

Max Probability

0.9264

PhyloCSF Frame 3

-2.188

CNTI Score

-0.320811356