McDonnell Genome Institute

Washington University

Transcript

lnc-SKAP2-73:1

Chromosome

chr7

Gene Name

lnc-SKAP2-73

Start

26499644

CPC Label

noncoding

End

26505349

Cancer

OV

Strand

-

Peptide

EVELPYAAGEIYNHCGK

Modified Peptide

n[145]EVELPYAAGEIYNHCGK

Peptide Length

17

ORF Length

34

Open Reading Frame (ORF)

LTTPNVGKDVKEVELPYAAGEIYNHCGKQLGNFL

Conservation Score

0.088

PhyloCSF Frame 1

-5.206

No. of Spectra

1

CPC Coding Probability

0.0210851

PhyloCSF Frame 2 

-5.21

CNTI Index

noncoding

Max Probability

0.4574

PhyloCSF Frame 3

-5.4

CNTI Score

-0.386573094