McDonnell Genome Institute

Washington University

Transcript

lnc-SIX2-6:1

Chromosome

chr2

Gene Name

lnc-SIX2-6

Start

44809080

CPC Label

noncoding

End

44811299

Cancer

OSCC

Strand

-

Peptide

TLQLTDHTK

Modified Peptide

n[145]TLQLTDHTK

Peptide Length

9

ORF Length

99

Open Reading Frame (ORF)

LQARKKVPTLHRVAWDKGLSGKWVAGVLSRSHHPKKQWAGRGTANHRRKPKKTLQLTDHTKLYQLALMRRGLCHVSFVPTPLPQDQHHHHHQHHHHHHQ

Conservation Score

0.233

PhyloCSF Frame 1

-5.382

No. of Spectra

10

CPC Coding Probability

0.0725422

PhyloCSF Frame 2 

-4.816

CNTI Index

noncoding

Max Probability

0.9712

PhyloCSF Frame 3

-4.804

CNTI Score

-0.37469191