McDonnell Genome Institute

Washington University

Transcript

lnc-SIX1-4:1

Chromosome

chr14

Gene Name

lnc-SIX1-4

Start

60507272

CPC Label

noncoding

End

60508683

Cancer

BRCA-Luminal B

Strand

-

Peptide

VHFLEIR

Modified Peptide

n[145]VHFLEIR

Peptide Length

7

ORF Length

53

Open Reading Frame (ORF)

LPTASTERLSFLRVHFLEIRQGRGKIKRAMKIMTKHKPSFPWSDFRISRKDNF

Conservation Score

1

PhyloCSF Frame 1

-2.981

No. of Spectra

1

CPC Coding Probability

0.0171286

PhyloCSF Frame 2 

-3.93

CNTI Index

noncoding

Max Probability

0.9959

PhyloCSF Frame 3

-4.882

CNTI Score

-0.371729011