McDonnell Genome Institute

Washington University

Transcript

lnc-SIVA1-1:3

Chromosome

chr14

Gene Name

lnc-SIVA1-1

Start

104767168

CPC Label

noncoding

End

104769738

Cancer

EOGC

Strand

+

Peptide

ASYFGELSLR

Modified Peptide

n[145]ASYFGELSLR

Peptide Length

10

ORF Length

41

Open Reading Frame (ORF)

LGRLIRTDKASYFGELSLRGQVWWLTPYNPNVLGGQGRRIT

Conservation Score

0.043

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.163976

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.583

PhyloCSF Frame 3

0

CNTI Score

-0.31709485