McDonnell Genome Institute

Washington University

Transcript

lnc-SIRT5-6:1

Chromosome

chr6

Gene Name

lnc-SIRT5-6

Start

13487931

CPC Label

noncoding

End

13488396

Cancer

OV

Strand

+

Peptide

GLAQGDIYK

Modified Peptide

n[145]GLAQGDIYK

Peptide Length

9

ORF Length

81

Open Reading Frame (ORF)

MKAKGLAQGDIYKQQACDWNPGPRVWARNRRLLRSPSKLACSNRAPPLRPRTHGSAAFFQDSPVLAGSHLPPTSPAPRPMP

Conservation Score

0.079

PhyloCSF Frame 1

-4.609

No. of Spectra

1

CPC Coding Probability

0.180754

PhyloCSF Frame 2 

-3.46

CNTI Index

noncoding

Max Probability

0.2143

PhyloCSF Frame 3

1.41

CNTI Score

-0.339694466