McDonnell Genome Institute

Washington University

Transcript

lnc-SIRT4-5:2

Chromosome

chr12

Gene Name

lnc-SIRT4-5

Start

120369439

CPC Label

noncoding

End

120371688

Cancer

LUAD

Strand

+

Peptide

KATEGCSFRR

Modified Peptide

KATEGCSFRR

Peptide Length

10

ORF Length

33

Open Reading Frame (ORF)

LLHCSLPAYRRKRKATEGCSFRRKQHPKHSESR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0579374

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9956

PhyloCSF Frame 3

0

CNTI Score

-0.380242978