McDonnell Genome Institute

Washington University

Transcript

lnc-SIRPG-4:1

Chromosome

chr20

Gene Name

lnc-SIRPG-4

Start

1721364

CPC Label

noncoding

End

1727746

Cancer

BRCA-Luminal B

Strand

-

Peptide

LVFVDLLEK

Modified Peptide

n[145]LVFVDLLEK

Peptide Length

9

ORF Length

43

Open Reading Frame (ORF)

LVFVDLLEKLLCDSGIDLHRYCRLQSEVVHLRISLSPGKRPPM

Conservation Score

0.029

PhyloCSF Frame 1

-4.472

No. of Spectra

1

CPC Coding Probability

0.010119

PhyloCSF Frame 2 

-1.259

CNTI Index

noncoding

Max Probability

0.9506

PhyloCSF Frame 3

-5.814

CNTI Score

-0.407792868