McDonnell Genome Institute

Washington University

Transcript

lnc-SIRPA-1:1

Chromosome

chr20

Gene Name

lnc-SIRPA-1

Start

1830028

CPC Label

coding

End

1836047

Cancer

OSCC

Strand

+

Peptide

CLRAPFSLHQGPEAGQGLK

Modified Peptide

n[145]CLRAPFSLHQGPEAGQGLK

Peptide Length

19

ORF Length

95

Open Reading Frame (ORF)

LQQASPESLLCTGLREARQDYTRGWRSWRECMSHARSATTLFYGLHGNRSRNQRVPRSSSHTHFSFSGDKCLRAPFSLHQGPEAGQGLKRLWLNL

Conservation Score

0.58

PhyloCSF Frame 1

-3.82

No. of Spectra

3

CPC Coding Probability

0.820573

PhyloCSF Frame 2 

-2.76

CNTI Index

noncoding

Max Probability

0.8387

PhyloCSF Frame 3

-4.493

CNTI Score

-0.341467801