McDonnell Genome Institute

Washington University

Transcript

lnc-SIPA1L1-4:1

Chromosome

chr14

Gene Name

lnc-SIPA1L1-4

Start

71219099

CPC Label

noncoding

End

71222724

Cancer

OV

Strand

+

Peptide

ALDMWSFVILLR

Modified Peptide

n[145]ALDMWSFVILLR

Peptide Length

12

ORF Length

63

Open Reading Frame (ORF)

LSTILKALDMWSFVILLRCNFFFFFETESRSVVQAGVQWHDLSSLQSPPPGFKQFSCLSLLSS

Conservation Score

0.867

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.288342

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8854

PhyloCSF Frame 3

0

CNTI Score

-0.357974228